PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0362s0290.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 1087aa    MW: 124691 Da    PI: 6.1527
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0362s0290.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS167.79.3e-5273503374
                    GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRla.ayfteALaarlarsvselykalppsetseknsseelaalklfsev. 87 
                             + L+ecA+a++ g l  a++lL+r++ las+++++ +R+a +y +eAL +r+++  + +    p+   +             + ++ 
  SapurV1A.0362s0290.1.p   7 KRLMECAKAIEGGRLDDADSLLERIQSLASQEASTSTRVAaKYCVEALVRRVYGIRPLCPLRWPTFLFE------------PWEDMw 81 
                             68*******************************7777775169***********333333333333332............222221 PP

                    GRAS  88 sPilkfshltaNqaIleave.geervHiiDfdisqG.lQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                               +l f++ t+   I +a++ g++r+HiiD++i+ G l W  +++ L  R +g  s+ iT v +     k++ +e  ++        
  SapurV1A.0362s0290.1.p  82 QRFLVFAQTTTEDIIADALNpGNKRLHIIDLSIMSGtLRWTVFINRLKLRYGGLQSVLITSVTP-----KRSSQEWDRKVG------ 157
                             23789**************8567************9569************************9.....677777777765...... PP

                    GRAS 173 gvpfefnvlvakrledl..eleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                             +v++e++ l+ ++ +d+   +++Lr k+ +E+++V++++ l +ll++++++e+    vL+ v++l+++++v++eqea++ns+++ +r
  SapurV1A.0362s0290.1.p 158 DVDLEWRQLIYNSPDDIvkCFSRLRRKRkDEMVVVSWHFILRKLLAQDGAIEQ----VLSRVRDLKADIMVISEQEANLNSPNLSKR 240
                             68888888877766665445789999888***********************9....****************************** PP

                    GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                             + ++++yysa + sl++     ++  ++    +++r+i nvvaceg +r+er e++ +W++rl++aGF+pvpl+    +   l l+ 
  SapurV1A.0362s0290.1.p 241 LEQSFQYYSAALQSLKQD----NDIFVSRKTSYFRRQIGNVVACEGIDRVERIESFDQWQHRLSQAGFSPVPLQAARLSFNLLFLED 323
                             ***************888....44455555579****************************************98777666666665 PP

                    GRAS 344 vksdgyrve.eesgslvlgWkdrpLvsvSaWr 374
                             ++     +e  + +   l  ++ +L ++SaW+
  SapurV1A.0362s0290.1.p 324 FE-----IElMDGHKQKLKCHGCSLAVASAWK 350
                             55.....5523344445888999999999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.5431334IPR005202Transcription factor GRAS
PfamPF035143.2E-497350IPR005202Transcription factor GRAS
PROSITE profilePS5080810.544689745IPR003656Zinc finger, BED-type
SMARTSM006141.5E-11689740IPR003656Zinc finger, BED-type
PfamPF028926.4E-5692737IPR003656Zinc finger, BED-type
SuperFamilySSF576671.55E-7692745No hitNo description
SuperFamilySSF530982.35E-228281068IPR012337Ribonuclease H-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1087 aa     Download sequence    Send to blast
MARLLFKRLM ECAKAIEGGR LDDADSLLER IQSLASQEAS TSTRVAAKYC VEALVRRVYG  60
IRPLCPLRWP TFLFEPWEDM WQRFLVFAQT TTEDIIADAL NPGNKRLHII DLSIMSGTLR  120
WTVFINRLKL RYGGLQSVLI TSVTPKRSSQ EWDRKVGDVD LEWRQLIYNS PDDIVKCFSR  180
LRRKRKDEMV VVSWHFILRK LLAQDGAIEQ VLSRVRDLKA DIMVISEQEA NLNSPNLSKR  240
LEQSFQYYSA ALQSLKQDND IFVSRKTSYF RRQIGNVVAC EGIDRVERIE SFDQWQHRLS  300
QAGFSPVPLQ AARLSFNLLF LEDFEIELMD GHKQKLKCHG CSLAVASAWK FTDRPQSSSG  360
LCEMQDRVDG SEEMASSSES EDDEENDPCI MAVINLWCTQ GSSMNRIAAS AKLFDILEYI  420
CPLYDIPVAV TWISYNRGGN TNSNEKRILL DKFVGAYALH RLEEGQGVAG KALQSNIHIQ  480
HDISVLDPAD FPDSDSQRLW QNRTFNASFA IRLTSTHSCK DDYVLEFFLP YGMEDTSERE  540
LLISKVLRTL QENCLESWKV WVRELNEASG NGVGLDDERM SNIPHEAISS IFQLPSSDGV  600
LGGNEFMTFN PTSNQAGETH EPLEQDVQEQ SAIAAPALND ENALLIVDGG LQSTNKRRKK  660
QSAIATPARN DENASLTVDG GLQSTNKHRK ISSVWDNFDE HRGENGEVWA TCKHCKKMYR  720
AESKRGTTNL HKHLRKCLPS RQDEAEQQPL IFKTGGSSTS VIQRNSVINQ ERSHLDIETM  780
IINHGYPLDM VQHEFFEIFV KNLQPMFELH SKDDVEANVL AICRQEKEKL IKYFDSLSCL  840
LSLTLELWSS NDKMLTHCSL TVHFIDYGWQ LKKKILAFRN LRYNYDMGTV HEFIKSVLGE  900
WRINKNIHFI LLDITPSKEH MIGELRSKVS DKAPLVHGHL FCVPSYDQIL SLLVQDGFSE  960
IRSLLYKIRE CIEYINESSL RRQWFQEAIN KGSLQDKEMP FQDVPARWDT TFLMLESSLE  1020
FREAFNHLEQ FDCDFKVNPS AEEWNKATSI CECLKEFHKS ASNFPTTSEG YFLSVRDVYK  1080
NFLKWK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181186RRKRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041340.10.0PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X5
TrEMBLU5FML80.0U5FML8_POPTR; Uncharacterized protein
STRINGPOPTR_0016s02680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1556826
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.19e-41GRAS family protein